Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGAITIVAVYQAFLKYPDYGTKLLSLTHNQTAYSPTLIL-STLTAGAKSATYFFHKTTSMLKRKKQRKQLLVVVAAMIIIYFLPVITQVFHQ-YFG 2Q2F Chain:A ((18-88)) -GSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQ---EELNAQVEKHKEKLKQLEEEKRRQKI---------------------EMWDS

General information: TITO was launched using: RESULT: Template: 2Q2F.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 15 -103 -6.83 -1.49 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain A : 0.55 3D Compatibility (PKB) : -6.83 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.55 QMean score : -0.026

(partial model without unconserved sides chains): PDB file : Tito_2Q2F.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2Q2F-query.scw PDB file : Tito_Scwrl_2Q2F.pdb: