Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLLSMNLQLFAHKKGGGSTSNGRDSESKRLGAKRADGQTVTGGSILYRQRGTKIYPGVNVGIGGDDTLFAKVDGVVRFERKG-RNKKQVSVYPVAQEA 5GAH Chain:X ((10-82)) ------------------TRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISI-------

General information: TITO was launched using: RESULT: Template: 5GAH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 258 -12046 -46.69 -167.31 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain X : 0.77 3D Compatibility (PKB) : -46.69 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.563

(partial model without unconserved sides chains): PDB file : Tito_5GAH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5GAH-query.scw PDB file : Tito_Scwrl_5GAH.pdb: