Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNYIAAAIAIMGAAIGAGYGNGQVISKTIESMARQPEMSGQFRTTMFIGVALVEAVPILGVVVALILVFGV 1L6T Chain:A ((10-78)) --YMAAAVMMGLAAIGDAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVNAIPMIAVGLGLYVMFAV

General information: TITO was launched using: RESULT: Template: 1L6T.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 141 -28647 -203.17 -415.17 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.87 3D Compatibility (PKB) : -203.17 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.87 QMean score : 0.446

(partial model without unconserved sides chains): PDB file : Tito_1L6T.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1L6T-query.scw PDB file : Tito_Scwrl_1L6T.pdb: