Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGTLSRVKAAQLVLAGGPRNHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQ------HLWFQSVLDMLRHF 1D4T Chain:A ((6-87)) VYHGKISRETGEKLLLATG--LDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAF

General information: TITO was launched using: RESULT: Template: 1D4T.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 244 -33101 -135.66 -435.53 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain A : 0.74 3D Compatibility (PKB) : -135.66 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.699

(partial model without unconserved sides chains): PDB file : Tito_1D4T.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1D4T-query.scw PDB file : Tito_Scwrl_1D4T.pdb: