Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKINKVVVKAGESYTHIQYLFEQESFDHVPALVRYH 1MIL Chain:A ((9-80)) WFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDP---EG------VVRTKDHRFESVSHLISYH

General information: TITO was launched using: RESULT: Template: 1MIL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 250 -36481 -145.92 -506.67 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.76 3D Compatibility (PKB) : -145.92 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.76 QMean score : 0.539

(partial model without unconserved sides chains): PDB file : Tito_1MIL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1MIL-query.scw PDB file : Tito_Scwrl_1MIL.pdb: