Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence GCPYSVRRYDKEVKWDIVEAGKSHIRVIDGYPATISADQDCKLKIKGLARLKYTIAPGDSSTIKPKRGCTAPRVT-- 4GI3 Chain:C ((21-77)) -CP------------SICPLIYAPVCVEDSNQDFYLFVNECEVRKCGCEA-------GFVYTFVPREMCKATTSLCP

General information: TITO was launched using: RESULT: Template: 4GI3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 184 -13155 -71.49 -239.18 target 2D structure prediction score : 0.47 Monomeric hydrophicity matching model chain C : 0.61 3D Compatibility (PKB) : -71.49 2D Compatibility (Sec. Struct. Predict.) : 0.47 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.211

(partial model without unconserved sides chains): PDB file : Tito_4GI3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4GI3-query.scw PDB file : Tito_Scwrl_4GI3.pdb: