Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTEFSLDLLLEAIKLARWTYYYHLKQLDKPDKDQ 3E7L Chain:D ((33-58)) ---YDLKRTAEEIGIDLSNLYRKIKSLNI-----

General information: TITO was launched using: RESULT: Template: 3E7L.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 41 -8705 -212.32 -334.81 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain D : 0.69 3D Compatibility (PKB) : -212.32 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.525

(partial model without unconserved sides chains): PDB file : Tito_3E7L.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3E7L-query.scw PDB file : Tito_Scwrl_3E7L.pdb: