Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPRTFPCPRCGEPSVWEGNEFRPFCSERCKLIDLGAWANDEYRLPTQDAPQQDKGSQHEDDYED 3WWN Chain:B ((1-15)) --MVGTCPECGAELRLE-----------------------------------------------

General information: TITO was launched using: RESULT: Template: 3WWN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 20 -1164 -58.20 -77.60 target 2D structure prediction score : 1.00 Monomeric hydrophicity matching model chain B : 0.66 3D Compatibility (PKB) : -58.20 2D Compatibility (Sec. Struct. Predict.) : 1.00 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.966

(partial model without unconserved sides chains): PDB file : Tito_3WWN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3WWN-query.scw PDB file : Tito_Scwrl_3WWN.pdb: