Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDNSKLPINQIIARINDAAKNSEALVLTAEEVKILSKDIGDKVFIPVLTNEQVVQLVKEGKLGQKINNTKD 5G49 Chain:A ((49-89)) --------SFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLT----------------------

General information: TITO was launched using: RESULT: Template: 5G49.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 91 -11558 -127.01 -281.90 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -127.01 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.246

(partial model without unconserved sides chains): PDB file : Tito_5G49.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5G49-query.scw PDB file : Tito_Scwrl_5G49.pdb: