Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMVFRSGL--LLACAAVFLQIAVFLQPLL-PKQYQIAPVCETITRALL-K---------PKAQTEAMSHAMHHTHHQHHIEQ---------------------------AQVPDHHDHHDANHQCQYCTVYANLVLPPEF----GVKEVLVRIQVRLVAYQQAFRHVYFALQRLFLLPQG----RAPPLFA---------------------
4RD8 Chain:A ((9-218))NPIKRALQGELLQNEPFIQLCTKIENYLMD-TEAVNEQLIELNEQLTMRLKEKGLKPGEKGATKQLRTLIQEILTEAGFREGMLQTIGNKPLAAADFMFLVSSGFMLKDSSLRASSHGELTHAIQWCLIILKRKKDSSFLENIPTSEICDRIYKKLGHQDSSNPNYPFTCWDVLIDKLGEIDSRSPEWLSDHIQNDEDQIFPVLREVIKNR


General information:
TITO was launched using:
RESULT:

Template: 4RD8.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1 46 45.50 0.32
target 2D structure prediction score : 0.52
Monomeric hydrophicity matching model chain A : 0.62

3D Compatibility (PKB) : 45.50
2D Compatibility (Sec. Struct. Predict.) : 0.52
1D Compatibility (Hydrophobicity) : 0.62
QMean score : ?

(partial model without unconserved sides chains):
PDB file : Tito_4RD8.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4RD8-query.scw
PDB file : Tito_Scwrl_4RD8.pdb: