Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGQDHIEQHRRYIVISYAFMFLALFTVIFAAFAYLVARKVAVVDDAEVWIHAHALWIMRNGILFLLMSVFAVAWFIPLFFFAWDSNLWVTASTVAGVVFSAIAWLFLLNAWLKGLSKYLKNKAVF 2F95 Chain:B ((24-76)) -------------------IFVGALTVLFGAIAYGEVTAAAATGDAAAVQEAAVSAILGLIILLGINLGLVA-----------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2F95.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 80 -17138 -214.23 -323.36 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain B : 0.51 3D Compatibility (PKB) : -214.23 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.277

(partial model without unconserved sides chains): PDB file : Tito_2F95.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2F95-query.scw PDB file : Tito_Scwrl_2F95.pdb: