Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRNYFSVFFSNTQVRTLISQPLDKRCSKASFSVVSQIYAKMWKAIFTKFFLLLETKQLFHNL------- 2NWT Chain:A ((1-69)) MPKIIEAVYENGVFKPLQKVDLKEGERVKIKLELKVEPIDLGEPVSVEEIKKIRDGTWMSSLEHHHHHH

General information: TITO was launched using: RESULT: Template: 2NWT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 50 -7406 -148.11 -119.44 target 2D structure prediction score : 0.23 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -148.11 2D Compatibility (Sec. Struct. Predict.) : 0.23 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.012

(partial model without unconserved sides chains): PDB file : Tito_2NWT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2NWT-query.scw PDB file : Tito_Scwrl_2NWT.pdb: