Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSLLCKLVPERCIACGLCQIEAPDIFDYDEEGIVLFAQEPEAHQQFVMPEEETY--VKKAYQKCPVRAILLENKI 4DHV Chain:A ((9-64)) ---------DTCIGCAICASLCPDVFEMNDEG----KAQPKVE---VIEDEELYNCAKEAMEACPVSAITIE---

General information: TITO was launched using: RESULT: Template: 4DHV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 180 -13123 -72.91 -243.02 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : -72.91 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.468

(partial model without unconserved sides chains): PDB file : Tito_4DHV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4DHV-query.scw PDB file : Tito_Scwrl_4DHV.pdb: