Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence NCSVQVLDANNFQIGTACIPKGGQGSVRYNG-----GSYFITATSSCGLGFVSTQTH-PAGWQLKLLGNC- 5WUR Chain:C ((3-72)) -CPEQIVQLMHMHLDGDILPKDEHVLNEHLETCEKCRKHFYEMEKSIALVRSTSHVEAPADFTANVMAKLP

General information: TITO was launched using: RESULT: Template: 5WUR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 106 -12120 -114.34 -192.38 target 2D structure prediction score : 0.27 Monomeric hydrophicity matching model chain C : 0.70 3D Compatibility (PKB) : -114.34 2D Compatibility (Sec. Struct. Predict.) : 0.27 1D Compatibility (Hydrophobicity) : 0.70 QMean score : -0.181

(partial model without unconserved sides chains): PDB file : Tito_5WUR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5WUR-query.scw PDB file : Tito_Scwrl_5WUR.pdb: