Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYKPEISREQAIALLKDQEPGAFIIRD-SHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQH 2IUH Chain:A ((13-53)) WYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR-------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2IUH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 89 -8990 -101.01 -224.75 target 2D structure prediction score : 0.90 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -101.01 2D Compatibility (Sec. Struct. Predict.) : 0.90 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.697

(partial model without unconserved sides chains): PDB file : Tito_2IUH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2IUH-query.scw PDB file : Tito_Scwrl_2IUH.pdb: