Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTA-EGLYRITEKKAFRGLTELVEFY 2ABL Chain:A ((146-221)) WYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHH

General information: TITO was launched using: RESULT: Template: 2ABL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 259 -20531 -79.27 -273.75 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.80 3D Compatibility (PKB) : -79.27 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.639

(partial model without unconserved sides chains): PDB file : Tito_2ABL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ABL-query.scw PDB file : Tito_Scwrl_2ABL.pdb: