Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHY 1FU6 Chain:A ((13-88)) WYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKSIKIFHRDGKYGFSDPLTFNSVVELINHY

General information: TITO was launched using: RESULT: Template: 1FU6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 296 -27957 -94.45 -367.85 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 0.99 3D Compatibility (PKB) : -94.45 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.99 QMean score : 0.507

(partial model without unconserved sides chains): PDB file : Tito_1FU6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1FU6-query.scw PDB file : Tito_Scwrl_1FU6.pdb: