Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLDLQPKKSSDIFFQILYLLLTDLLMSDHILDKNKYRILFHQSKQVLGALNY 4AXG Chain:C ((23-81)) VVSSKPVKSYT---------------RSRLMDIRNGMIELEGRLRRMNIWRT

General information: TITO was launched using: RESULT: Template: 4AXG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 17 -601 -35.32 -16.23 target 2D structure prediction score : 0.35 Monomeric hydrophicity matching model chain C : 0.53 3D Compatibility (PKB) : -35.32 2D Compatibility (Sec. Struct. Predict.) : 0.35 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.342

(partial model without unconserved sides chains): PDB file : Tito_4AXG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4AXG-query.scw PDB file : Tito_Scwrl_4AXG.pdb: