Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGVVGKQSSSFSLLFWLFSLSSGKVTCFKSGSLGNSSNILPKLSHFVNFTAIGVPRF 4QIW Chain:P ((8-49)) CAKCGKE----------VELDLATAREVRCPYCGSKILYKPRPRVARRVKAI-----

General information: TITO was launched using: RESULT: Template: 4QIW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain P - contact count / total energy / energy per contact / energy per residue : 87 -2220 -25.52 -52.86 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain P : 0.56 3D Compatibility (PKB) : -25.52 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.299

(partial model without unconserved sides chains): PDB file : Tito_4QIW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4QIW-query.scw PDB file : Tito_Scwrl_4QIW.pdb: