Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTVEEEKAFLARHLKATEA-GEFVTIDALFQAYKKELGRSYTRDAFYQLLKRHGWRNITPRPEHPRKADAQTIVASKNKISIQEDKKAL 4IVN Chain:A ((25-77)) ---------VADYILENAHDVQFQTITDLARN----T--QTSEATVVRLCRDMGYKGYS------------------------------

General information: TITO was launched using: RESULT: Template: 4IVN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 118 -3377 -28.61 -78.52 target 2D structure prediction score : 0.84 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : -28.61 2D Compatibility (Sec. Struct. Predict.) : 0.84 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.704

(partial model without unconserved sides chains): PDB file : Tito_4IVN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4IVN-query.scw PDB file : Tito_Scwrl_4IVN.pdb: