Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRQMMKMNKKSSYVVKRLLLVIIVLILGTLALGIGLMVGYGILGKGQDPWAILSPAKWQELIHKFTGN 1Q90 Chain:M ((7-29)) ---------------------AGTALTMVGMTLVGLAIGFVLLR------------------------

General information: TITO was launched using: RESULT: Template: 1Q90.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain M - contact count / total energy / energy per contact / energy per residue : 1 -170 -170.00 -7.39 target 2D structure prediction score : 0.91 Monomeric hydrophicity matching model chain M : 0.56 3D Compatibility (PKB) : -170.00 2D Compatibility (Sec. Struct. Predict.) : 0.91 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.196

(partial model without unconserved sides chains): PDB file : Tito_1Q90.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Q90-query.scw PDB file : Tito_Scwrl_1Q90.pdb: