Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTAREQGVVKWFNDTKGFGFIQRNGGDDVFVHFRAIVGDGHRSLRDGQRVEFSVVQGQKGFQAENVQPLD 3PF5 Chain:A ((3-63)) -----EGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANV----

General information: TITO was launched using: RESULT: Template: 3PF5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 248 -37348 -150.60 -612.26 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.83 3D Compatibility (PKB) : -150.60 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.83 QMean score : 0.704

(partial model without unconserved sides chains): PDB file : Tito_3PF5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3PF5-query.scw PDB file : Tito_Scwrl_3PF5.pdb: