Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFQGYSKDRREETCSYCGAIYIVDIPGLPGHEEREEYFCPECSHVNFARASNSPRVSLVKARTDGKNDKSPSFQALIDSYKDE 5X51 Chain:X ((28-61)) --------GVKYTCGACAHNFSLN--------KSDPVRCKECGHRVIYKA---------------------------------

General information: TITO was launched using: RESULT: Template: 5X51.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 94 -13477 -143.37 -396.38 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain X : 0.63 3D Compatibility (PKB) : -143.37 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.535

(partial model without unconserved sides chains): PDB file : Tito_5X51.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5X51-query.scw PDB file : Tito_Scwrl_5X51.pdb: