Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMKLNALLCSAVLATSMVTVAHADNTTHVAAASALGSIAGTAIGKSMGGTNGGYIGAALGAAGGSALGNKISKDRDADRSSKYWKKNTVIIVTNYRDEIGLKTPSGVFL 3URQ Chain:A ((182-246)) -----AIFESEGLSPSRVCIGHSDDTDDLSYLTALAA-RGYLIG--LDGIPWSAIGLEDNASASAILGNRSWQTR----------------------------------

General information: TITO was launched using: RESULT: Template: 3URQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 170 -5741 -33.77 -88.32 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -33.77 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.69 QMean score : -0.085

(partial model without unconserved sides chains): PDB file : Tito_3URQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3URQ-query.scw PDB file : Tito_Scwrl_3URQ.pdb: