Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKMTAKIALFNAAIVTMGSLAACQSTTQPPKPEHGMMQDGPRDGHHHRMKHREFTPEQKAAWEQHRAERKARFEQIQKACEGKAVGQTVNVQVGDKTLEGTCNLRFEPKRPQPPVNAPAPVAS 3QZC Chain:B ((88-109)) ---------------------------------------------------RLLTPEQQAVLNEKHQQRMEQL--------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3QZC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 8 -474 -59.25 -21.55 target 2D structure prediction score : 0.82 Monomeric hydrophicity matching model chain B : 0.62 3D Compatibility (PKB) : -59.25 2D Compatibility (Sec. Struct. Predict.) : 0.82 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 1.042

(partial model without unconserved sides chains): PDB file : Tito_3QZC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3QZC-query.scw PDB file : Tito_Scwrl_3QZC.pdb: