Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRNKYKEVLCVAKEDMIEVEGTVVETLPNAMFKVELENGHQVLATVSGKIRMHYIRILPGDKVTVELSPYDLN--RGRITYRFK 2NCH Chain:A ((10-78)) ---------------LFEVEGAVTALLPAAEFRVKLDNEHEIICHVSGKVRRSKIRIIIGDRVLVEMSIYDRNAKKGRIIRRLK

General information: TITO was launched using: RESULT: Template: 2NCH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 267 -41033 -153.68 -612.43 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain A : 0.80 3D Compatibility (PKB) : -153.68 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.499

(partial model without unconserved sides chains): PDB file : Tito_2NCH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2NCH-query.scw PDB file : Tito_Scwrl_2NCH.pdb: