Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------------------------------------------------------------------------------MSQPLDKRCSKASFSVVSQIYAKMWKPMFTKFFLLLETKRLYHNLLINGVQSAVPRY-----------------------
4D10 Chain:H ((14-212))FSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGL-PVEEAVKGILEQGWQADSTTRMVLPRKPEQQLARLTDYVAFLEN


General information:
TITO was launched using:
RESULT:

Template: 4D10.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 130 7598 58.44 135.67
target 2D structure prediction score : 0.63
Monomeric hydrophicity matching model chain H : 0.59

3D Compatibility (PKB) : 58.44
2D Compatibility (Sec. Struct. Predict.) : 0.63
1D Compatibility (Hydrophobicity) : 0.59
QMean score : 0.239

(partial model without unconserved sides chains):
PDB file : Tito_4D10.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4D10-query.scw
PDB file : Tito_Scwrl_4D10.pdb: