Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLYDLLQTKHIYIVCGKTDLRKGIDGLASLIQQEYQLELYEDAVFLFCGNRQDRFKLLYWDGDGFLLCYKRIENGKLKWPRTKDEVRTLTNQPVKWLLEGLSIDQPRAILPGKKGVF 3NOK Chain:B ((99-148)) ------------------------EGLASDGERLYQLTWTEGLLFTWSGMPPQRERTTRYSGEGWGLCYW---NGKL----------------------------------------

General information: TITO was launched using: RESULT: Template: 3NOK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 160 -18565 -116.03 -371.30 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain B : 0.61 3D Compatibility (PKB) : -116.03 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.272

(partial model without unconserved sides chains): PDB file : Tito_3NOK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3NOK-query.scw PDB file : Tito_Scwrl_3NOK.pdb: