Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKRNYLVISIIALSVLLFFEITSVASLITEVKGQTHSSEHSSQSFKQSEQSTIKSQSTETANVKEAIQESAEKVQSQSSQSTQDSTEAIQDPTVKSVAISFDDGPGATTTPQLLRILKEKTCMSLFSS 2Y8U Chain:B ((21-65)) ----------------------------------------------------------------------------------PTGQVITQCTTPNTIALTFDDGPSEY-TPQLLDLLSRYSARATFFV

General information: TITO was launched using: RESULT: Template: 2Y8U.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 68 -11589 -170.42 -257.52 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain B : 0.62 3D Compatibility (PKB) : -170.42 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.456

(partial model without unconserved sides chains): PDB file : Tito_2Y8U.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2Y8U-query.scw PDB file : Tito_Scwrl_2Y8U.pdb: