Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------MILVNIEGRLEKDDGTEEKKGIQKEVTIDRKANLKSHRLYWIGRRAQDVFCSALALIILSPVMLITALAIVIDDLGGSPIFAQNKVSR-------NGRLFKFYKFCSMCVDAEAKLDALLSQNEMDGPVFKIKNDPRITRVGKFI
4QXA Chain:B ((9-179))ATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSVGDLDYEKSVYWDYAVTIRLEEIVYLHCHQQV-DSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKG---KVATDYVFRIIYP--


General information:
TITO was launched using:
RESULT:

Template: 4QXA.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 507 19368 38.20 146.72
target 2D structure prediction score : 0.40
Monomeric hydrophicity matching model chain B : 0.64

3D Compatibility (PKB) : 38.20
2D Compatibility (Sec. Struct. Predict.) : 0.40
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.034

(partial model without unconserved sides chains):
PDB file : Tito_4QXA.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4QXA-query.scw
PDB file : Tito_Scwrl_4QXA.pdb: