Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------WYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSV------------------------------------------------------------------------
2IZV Chain:A ((17-179))NLYFQSMLVPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLKEYHYKSKVR


General information:
TITO was launched using:
RESULT:

Template: 2IZV.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 203 -160 -0.79 -2.22
target 2D structure prediction score : 0.50
Monomeric hydrophicity matching model chain A : 0.60

3D Compatibility (PKB) : -0.79
2D Compatibility (Sec. Struct. Predict.) : 0.50
1D Compatibility (Hydrophobicity) : 0.60
QMean score : 0.453

(partial model without unconserved sides chains):
PDB file : Tito_2IZV.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2IZV-query.scw
PDB file : Tito_Scwrl_2IZV.pdb: