Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY 1JYQ Chain:B ((5-80)) WFFGKIPRAKAE-EMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVK-FNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 1JYQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 275 -43395 -157.80 -570.99 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain B : 0.79 3D Compatibility (PKB) : -157.80 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.79 QMean score : 0.752

(partial model without unconserved sides chains): PDB file : Tito_1JYQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1JYQ-query.scw PDB file : Tito_Scwrl_1JYQ.pdb: