Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence EQSYRWDCTVRLFYTKAGWSQVRSDYIHVPPQGTLVNYDYASLRWGIEVTPGCVGRKLGIMAKGYWVTVSDWENKNIQLIKEPVWS 4N2R Chain:A ((15-49)) --TYRWTSSAPLAQPKDGWVSLK-DFTHVPYNGQHLVY------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4N2R.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 36 -6541 -181.68 -186.87 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -181.68 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.361

(partial model without unconserved sides chains): PDB file : Tito_4N2R.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4N2R-query.scw PDB file : Tito_Scwrl_4N2R.pdb: