Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSIQQLKELFGNQEAVLELVQLEGGELALRNAGSAKEPLVKIQFSDELKAILGEQTPIVAQHMIQAALFGLLEKQVNEWQAEVVDEQPKFLS 5ANB Chain:I ((147-206)) ---------------------LVGTYCALTNQGALVHPMTSIADQDELSSLL--QVPLVAGTVNRGNECVAAGCVVNDWTAIV---------

General information: TITO was launched using: RESULT: Template: 5ANB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain I - contact count / total energy / energy per contact / energy per residue : 198 -19091 -96.42 -318.18 target 2D structure prediction score : 0.25 Monomeric hydrophicity matching model chain I : 0.64 3D Compatibility (PKB) : -96.42 2D Compatibility (Sec. Struct. Predict.) : 0.25 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.097

(partial model without unconserved sides chains): PDB file : Tito_5ANB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5ANB-query.scw PDB file : Tito_Scwrl_5ANB.pdb: