Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEFRGGRKMEKIEWRKDKSYSMKKSPQILEVPKKSFFSIRGIGDPNQEDFKRRVACLYAVSYAIRMSPKKNWLIPDYQMYTVYPLEGQWGLQEKYLHEPVMKKEHFSYQLMIRQPDFVTEAIAQEAIQRSSKLPEDLKEQVVFKKMEEGLCAQILHVGPYAEEPATFEKLEAFIAKEGYERASKEHKEIYISDPRKSAPEKMKTILRVKIEKG 3E0H Chain:A ((86-157)) -------------------------------------------------------------------------------------------------------------------------------------------RVVTGLTPSGKAASSLYIGPYGEIEAVYDALMKWVDDNGFDL-SGEAYEIYLDNPAETAPDQLRTRVSLMLHE-

General information: TITO was launched using: RESULT: Template: 3E0H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 206 -18540 -90.00 -257.49 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -90.00 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.476

(partial model without unconserved sides chains): PDB file : Tito_3E0H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3E0H-query.scw PDB file : Tito_Scwrl_3E0H.pdb: