Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence SSGSVGSTSPERPVSPGSFDEHEGDQRPCKVTIEMGVSPGGLFRQLYGSDYATRGGTVNINQYQCTVDVMCKNPSCPG-LPARWEVTSFDKTKQRETHNQPAGGSVWAVGKKHDL 1CYQ Chain:A ((87-135)) ----------------------------------------------------------NINGKTCTASALCHNTRCHNPLHLCWE--SLDDNKGRNWCPGPNGGCVHAV------

General information: TITO was launched using: RESULT: Template: 1CYQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 111 1477 13.31 30.77 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : 13.31 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.272

(partial model without unconserved sides chains): PDB file : Tito_1CYQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1CYQ-query.scw PDB file : Tito_Scwrl_1CYQ.pdb: