Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ICDIVIRFEGAVVETGTMGPSTAKTFNLITDQISITVDHNCNITHWTQVEKFTVSSTLRNPPAAAAARR 2WNF Chain:A ((121-144)) -HDFVLRMNKAPTE-------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2WNF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 3 -162 -53.83 -12.42 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -53.83 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.674

(partial model without unconserved sides chains): PDB file : Tito_2WNF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2WNF-query.scw PDB file : Tito_Scwrl_2WNF.pdb: