Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WPLTADCNIYPKIGDKSVGWGSGFMGSVAHVRIEKVDYA---VALWKRVCKAVKLEELPPGVELFAEPNTLRR-NPQPVQRRGLVGREPLGGLELQE 2ZF3 Chain:A ((78-135)) ---------------------------------QKVAYGRERTA--EQLCERPLDDETGPFAELFLPRDVLRRLGARHIGRRVVLGREADG------

General information: TITO was launched using: RESULT: Template: 2ZF3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 49 4678 95.47 89.96 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 95.47 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.340

(partial model without unconserved sides chains): PDB file : Tito_2ZF3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ZF3-query.scw PDB file : Tito_Scwrl_2ZF3.pdb: