Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KCNISILKDGKYFTQKQEIAGWTV-KFHDLDGNYVGKCKNAHTYACTYVTCEDLAPGYSPGKSKDVVASGNVGSLGHD 5TE4 Chain:G ((105-150)) -------------------AGFAILKCRDEDFNGTGPCKNVSTVQCTH------------------------------

General information: TITO was launched using: RESULT: Template: 5TE4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 46 2046 44.47 73.05 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain G : 0.62 3D Compatibility (PKB) : 44.47 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.145

(partial model without unconserved sides chains): PDB file : Tito_5TE4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5TE4-query.scw PDB file : Tito_Scwrl_5TE4.pdb: