Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceFCEYYI-KTPEGWQLLGWVKIGGQDELTWKGDSIGVKAEDTNCKVVLVNGQRAPVWLTAVP
2N37 Chain:A ((5-65))FCVYYDGHLPATRVLLMYVRIGTTATITARGHEFEVEAKDQNCKVILTNGKQAPDWLAAEP


General information:
TITO was launched using:
RESULT:

Template: 2N37.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 212 4569 21.55 76.15
target 2D structure prediction score : 0.47
Monomeric hydrophicity matching model chain A : 0.80

3D Compatibility (PKB) : 21.55
2D Compatibility (Sec. Struct. Predict.) : 0.47
1D Compatibility (Hydrophobicity) : 0.80
QMean score : 0.612

(partial model without unconserved sides chains):
PDB file : Tito_2N37.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2N37-query.scw
PDB file : Tito_Scwrl_2N37.pdb: