Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHY
1BFJ Chain:A ((11-85))WNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHY


General information:
TITO was launched using:
RESULT:

Template: 1BFJ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 247 -31836 -128.89 -424.48
target 2D structure prediction score : 0.77
Monomeric hydrophicity matching model chain A : 1.00

3D Compatibility (PKB) : -128.89
2D Compatibility (Sec. Struct. Predict.) : 0.77
1D Compatibility (Hydrophobicity) : 1.00
QMean score : 0.576

(partial model without unconserved sides chains):
PDB file : Tito_1BFJ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1BFJ-query.scw
PDB file : Tito_Scwrl_1BFJ.pdb: