Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGAIPRAEVAELLVHSGDFLVRESQGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHL 4E93 Chain:A ((15-99)) WYHGAIPRAEVAELLVHSGDFLVRESQ--QEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHL

General information: TITO was launched using: RESULT: Template: 4E93.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 248 -45300 -182.66 -656.52 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.99 3D Compatibility (PKB) : -182.66 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.99 QMean score : 0.391

(partial model without unconserved sides chains): PDB file : Tito_4E93.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4E93-query.scw PDB file : Tito_Scwrl_4E93.pdb: