Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence CHGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFA-VERENVI--EYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCY 5L04 Chain:A ((411-495)) CHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEK----QKQFKNFQIEVQKG-RYSLHGSDRSFPSLGDLMS--

General information: TITO was launched using: RESULT: Template: 5L04.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 247 -18355 -74.31 -244.73 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain A : 0.84 3D Compatibility (PKB) : -74.31 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.553

(partial model without unconserved sides chains): PDB file : Tito_5L04.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5L04-query.scw PDB file : Tito_Scwrl_5L04.pdb: