Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRH---RQ---VKHYRIFRLPNNWYYISPRLTFQCLEDLMNHY 3HCK Chain:A ((6-88)) WFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHY

General information: TITO was launched using: RESULT: Template: 3HCK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 244 -4783 -19.60 -62.12 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain A : 0.86 3D Compatibility (PKB) : -19.60 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.86 QMean score : 0.677

(partial model without unconserved sides chains): PDB file : Tito_3HCK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3HCK-query.scw PDB file : Tito_Scwrl_3HCK.pdb: