Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSF-YEQPDVEGHTSIVDLIEH 2IZV Chain:A ((36-113)) CYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEH

General information: TITO was launched using: RESULT: Template: 2IZV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 283 -23840 -84.24 -309.61 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain A : 0.85 3D Compatibility (PKB) : -84.24 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.577

(partial model without unconserved sides chains): PDB file : Tito_2IZV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2IZV-query.scw PDB file : Tito_Scwrl_2IZV.pdb: