Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSV 2C9W Chain:A ((19-91)) WYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRL-------------

General information: TITO was launched using: RESULT: Template: 2C9W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 193 -10903 -56.49 -184.79 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain A : 0.83 3D Compatibility (PKB) : -56.49 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.83 QMean score : 0.482

(partial model without unconserved sides chains): PDB file : Tito_2C9W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2C9W-query.scw PDB file : Tito_Scwrl_2C9W.pdb: