Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRSLTGVSNPTTDSARLVLAEANKAFADDSLTEQGLRDILQTVKDAIASLESIKESQSATKDGGQTAGKETAGEDESANQTQEISQGIK 1J1D Chain:B ((20-63)) --------QTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQTIYNLEA-------------------------------------

General information: TITO was launched using: RESULT: Template: 1J1D.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 31 1216 39.23 27.64 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain B : 0.70 3D Compatibility (PKB) : 39.23 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.634

(partial model without unconserved sides chains): PDB file : Tito_1J1D.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1J1D-query.scw PDB file : Tito_Scwrl_1J1D.pdb: