Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGSSENCPVLFYFEKIWSLSLKLLDCILDYQERFNGKTCQVSTNYKYLETFKVNFCLTDLHHLFDLYKITRDYASQTKPAIQAGVFILEDFRNILCTMM 3C0D Chain:A ((63-101)) ---------------------------------INGEMCVASPLYKQHFSLKSGQCLEDEAHCLKTWRVTVD---------------------------

General information: TITO was launched using: RESULT: Template: 3C0D.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 95 -11574 -121.83 -296.76 target 2D structure prediction score : 0.23 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : -121.83 2D Compatibility (Sec. Struct. Predict.) : 0.23 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.332

(partial model without unconserved sides chains): PDB file : Tito_3C0D.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3C0D-query.scw PDB file : Tito_Scwrl_3C0D.pdb: