Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIYKVFYQETKERSPRRETTRTLYLDIDASSELEGRITARQLVEENRPEY--NIEYIELLSDKLLDYEKETGAFEITEF 3F57 Chain:A ((1699-1764)) -----------------------------TDDLEQWISEKELVASS-PEMGQDFDHVTLLRDKFRDFARETGA------

General information: TITO was launched using: RESULT: Template: 3F57.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 42 6664 158.67 162.54 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : 158.67 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.488

(partial model without unconserved sides chains): PDB file : Tito_3F57.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3F57-query.scw PDB file : Tito_Scwrl_3F57.pdb: