Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKLNEVKEFVKELRGLSQEELAKRENELKKELFELRFQAATGQLEQTARLKEVKKQIARIKTVQSEAK 3J3W Chain:X ((5-56)) -----------EIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIREVRKAIARMKTV-----

General information: TITO was launched using: RESULT: Template: 3J3W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 89 -4619 -51.89 -88.82 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain X : 0.85 3D Compatibility (PKB) : -51.89 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.749

(partial model without unconserved sides chains): PDB file : Tito_3J3W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3J3W-query.scw PDB file : Tito_Scwrl_3J3W.pdb: